SCOP 1.71: Domain d1xzqa1: 1xzq A:118-211,A:372-450

Lineage for d1xzqa1 (1xzq A:118-211,A:372-450)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.25: TrmE connector domain [116878] (1 family)

5. Family a.24.25.1: TrmE connector domain [116879] (1 protein)

6. Protein TrmE connector domain [116880] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [116881] (2 PDB entries)

8. Domain d1xzqa1: 1xzq A:118-211,A:372-450 [116258]
   Other proteins in same PDB: d1xzqa2, d1xzqa3, d1xzqb1
   complexed with fon

Details for d1xzqa1

PDB Entry: 1xzq, 2.9 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima complexed with 5-formyl-THF

SCOP Domain Sequences for d1xzqa1:

Sequence; same for both SEQRES and ATOM records:

>d1xzqa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima}
mdltsaeavrdlieaksetslklslrnlkgglrdfvdslrrelievlaeirveldypdei
etntgevvtrlerikeklteelkkadagillnrgXqeifergsdslitnlrqkqllenvk
ghledaikslkegmpvdmasidleralnlldevtgrsfredlldtifsnfcvgk

Timeline for d1xzqa1:

• d1xzqa1 is new in SCOP 1.71
  
• d1xzqa1 appears in SCOP 1.73
  
• d1xzqa1 appears in the current release, SCOPe 2.08