Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
Superfamily d.250.1: Folate-binding domain [103025] (2 families) some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
Family d.250.1.2: TrmE formyl-THF-binding domain [117997] (1 protein) dimeric biological unit; one subunit domain corresponds to one "unswapped" subdomain of the other family automatically mapped to Pfam PF10396 |
Protein TrmE formyl-THF-binding domain [117998] (1 species) |
Species Thermotoga maritima [TaxId:2336] [117999] (2 PDB entries) Uniprot Q9WYA4 |
Domain d1xzpb1: 1xzp B:1-117 [116257] Other proteins in same PDB: d1xzpa1, d1xzpa2, d1xzpa4, d1xzpb2 complexed with so4 |
PDB Entry: 1xzp (more details), 2.3 Å
SCOPe Domain Sequences for d1xzpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzpb1 d.250.1.2 (B:1-117) TrmE formyl-THF-binding domain {Thermotoga maritima [TaxId: 2336]} mdtivavatppgkgaiailrlsgpdswkivqkhlrtrskivprkaihgwihengedvdev vvvfykspksytgedmvevmchggplvvkklldlflksgarmaepgeftkraflngk
Timeline for d1xzpb1:
View in 3D Domains from other chains: (mouse over for more information) d1xzpa1, d1xzpa2, d1xzpa3, d1xzpa4 |