![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein TrmE GTPase domain [117535] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117536] (2 PDB entries) Uniprot Q9WYA4 |
![]() | Domain d1xzpa2: 1xzp A:212-371 [116255] Other proteins in same PDB: d1xzpa1, d1xzpa3, d1xzpa4, d1xzpb1, d1xzpb2 complexed with so4 |
PDB Entry: 1xzp (more details), 2.3 Å
SCOPe Domain Sequences for d1xzpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} lrmvivgkpnvgkstllnrllnedraivtdipgttrdviseeivirgilfrivdtagvrs etndlverlgiertlqeiekadivlfvldasspldeedrkileriknkrylvvinkvdvv ekineeeiknklgtdrhmvkisalkgeglekleesiyret
Timeline for d1xzpa2: