Lineage for d1xzpa2 (1xzp A:212-371)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988545Protein TrmE GTPase domain [117535] (1 species)
  7. 988546Species Thermotoga maritima [TaxId:2336] [117536] (2 PDB entries)
    Uniprot Q9WYA4
  8. 988547Domain d1xzpa2: 1xzp A:212-371 [116255]
    Other proteins in same PDB: d1xzpa1, d1xzpa3, d1xzpb1
    complexed with so4

Details for d1xzpa2

PDB Entry: 1xzp (more details), 2.3 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima
PDB Compounds: (A:) Probable tRNA modification GTPase trmE

SCOPe Domain Sequences for d1xzpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}
lrmvivgkpnvgkstllnrllnedraivtdipgttrdviseeivirgilfrivdtagvrs
etndlverlgiertlqeiekadivlfvldasspldeedrkileriknkrylvvinkvdvv
ekineeeiknklgtdrhmvkisalkgeglekleesiyret

SCOPe Domain Coordinates for d1xzpa2:

Click to download the PDB-style file with coordinates for d1xzpa2.
(The format of our PDB-style files is described here.)

Timeline for d1xzpa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xzpb1