Lineage for d1xzpa2 (1xzp A:212-371)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582370Protein TrmE GTPase domain [117535] (1 species)
  7. 582371Species Thermotoga maritima [TaxId:243274] [117536] (2 PDB entries)
  8. 582372Domain d1xzpa2: 1xzp A:212-371 [116255]
    Other proteins in same PDB: d1xzpa1, d1xzpa3, d1xzpb1
    complexed with so4

Details for d1xzpa2

PDB Entry: 1xzp (more details), 2.3 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima

SCOP Domain Sequences for d1xzpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima}
lrmvivgkpnvgkstllnrllnedraivtdipgttrdviseeivirgilfrivdtagvrs
etndlverlgiertlqeiekadivlfvldasspldeedrkileriknkrylvvinkvdvv
ekineeeiknklgtdrhmvkisalkgeglekleesiyret

SCOP Domain Coordinates for d1xzpa2:

Click to download the PDB-style file with coordinates for d1xzpa2.
(The format of our PDB-style files is described here.)

Timeline for d1xzpa2:

Domains from other chains:
(mouse over for more information)
d1xzpb1