Lineage for d1xzpa1 (1xzp A:118-211,A:372-450)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765975Superfamily a.24.25: TrmE connector domain [116878] (1 family) (S)
  5. 765976Family a.24.25.1: TrmE connector domain [116879] (1 protein)
  6. 765977Protein TrmE connector domain [116880] (1 species)
  7. 765978Species Thermotoga maritima [TaxId:2336] [116881] (2 PDB entries)
    Uniprot Q9WYA4
  8. 765979Domain d1xzpa1: 1xzp A:118-211,A:372-450 [116254]
    Other proteins in same PDB: d1xzpa2, d1xzpa3, d1xzpb1
    complexed with so4

Details for d1xzpa1

PDB Entry: 1xzp (more details), 2.3 Å

PDB Description: Structure of the GTP-binding protein TrmE from Thermotoga maritima
PDB Compounds: (A:) Probable tRNA modification GTPase trmE

SCOP Domain Sequences for d1xzpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzpa1 a.24.25.1 (A:118-211,A:372-450) TrmE connector domain {Thermotoga maritima [TaxId: 2336]}
mdltsaeavrdlieaksetslklslrnlkgglrdfvdslrrelievlaeirveldypdei
etntgevvtrlerikeklteelkkadagillnrgXqeifergsdslitnlrqkqllenvk
ghledaikslkegmpvdmasidleralnlldevtgrsfredlldtifsnfcvgk

SCOP Domain Coordinates for d1xzpa1:

Click to download the PDB-style file with coordinates for d1xzpa1.
(The format of our PDB-style files is described here.)

Timeline for d1xzpa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xzpb1