SCOP 1.73: Domain d1xz5a_: 1xz5 A:

Lineage for d1xz5a_ (1xz5 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)

8. Domain d1xz5a_: 1xz5 A: [116245]
   Other proteins in same PDB: d1xz5b_, d1xz5d_

Details for d1xz5a_

PDB Entry: 1xz5, 2.11 Å

PDB Description: t-to-thigh quaternary transitions in human hemoglobin: alphal91a deoxy low-salt

PDB Compounds: (A:) hemoglobin alpha chain

SCOP Domain Sequences for d1xz5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xz5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahkarvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1xz5a_:

• d1xz5a_ first appeared in SCOP 1.71
  
• d1xz5a_ appears in SCOP 1.75
  
• d1xz5a_ appears in the current release, SCOPe 2.08