SCOP 1.71: Domain d1xz4c_: 1xz4 C:

Lineage for d1xz4c_ (1xz4 C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (162 PDB entries)

8. Domain d1xz4c_: 1xz4 C: [116243]
   Other proteins in same PDB: d1xz4b_, d1xz4d_
   complexed with hem; mutant

Details for d1xz4c_

PDB Entry: 1xz4, 2 Å

PDB Description: intersubunit interactions associated with tyr42alpha stabilize the quaternary-t tetramer but are not major quaternary constraints in deoxyhemoglobin: alphay42a deoxyhemoglobin no-salt

SCOP Domain Sequences for d1xz4c_:

Sequence; same for both SEQRES and ATOM records:

>d1xz4c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktafphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1xz4c_:

• d1xz4c_ is new in SCOP 1.71
  
• d1xz4c_ appears in SCOP 1.73
  
• d1xz4c_ appears in the current release, SCOPe 2.08