![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (19 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46487] (162 PDB entries) |
![]() | Domain d1xz4c_: 1xz4 C: [116243] Other proteins in same PDB: d1xz4b_, d1xz4d_ complexed with hem; mutant |
PDB Entry: 1xz4 (more details), 2 Å
SCOP Domain Sequences for d1xz4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xz4c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)} mlspadktnvkaawgkvgahageygaealermflsfpttktafphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1xz4c_: