Lineage for d1xz4a_ (1xz4 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473527Species Human (Homo sapiens) [TaxId:9606] [46487] (224 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 1473694Domain d1xz4a_: 1xz4 A: [116241]
    Other proteins in same PDB: d1xz4b_, d1xz4d_
    complexed with hem

Details for d1xz4a_

PDB Entry: 1xz4 (more details), 2 Å

PDB Description: intersubunit interactions associated with tyr42alpha stabilize the quaternary-t tetramer but are not major quaternary constraints in deoxyhemoglobin: alphay42a deoxyhemoglobin no-salt
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1xz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xz4a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktafphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d1xz4a_:

Click to download the PDB-style file with coordinates for d1xz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xz4a_: