Lineage for d1xyxa_ (1xyx A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 protein domains)
  6. 2499000Protein Prion protein domain [54100] (14 species)
  7. 2499039Species Mouse (Mus musculus) [TaxId:10090] [54101] (4 PDB entries)
    Uniprot P04925 120-231
  8. 2499041Domain d1xyxa_: 1xyx A: [116235]

Details for d1xyxa_

PDB Entry: 1xyx (more details)

PDB Description: mouse prion protein fragment 121-231
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1xyxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyxa_ d.6.1.1 (A:) Prion protein domain {Mouse (Mus musculus) [TaxId: 10090]}
vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcv
nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss

SCOPe Domain Coordinates for d1xyxa_:

Click to download the PDB-style file with coordinates for d1xyxa_.
(The format of our PDB-style files is described here.)

Timeline for d1xyxa_: