SCOP 1.75: Domain d1xyva_: 1xyv A:

Lineage for d1xyva_ (1xyv A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
   Uniprot P00323

8. Domain d1xyva_: 1xyv A: [116233]
   complexed with fmn; mutant

Details for d1xyva_

PDB Entry: 1xyv, 1.79 Å

PDB Description: low temperature (100k) crystal structure of flavodoxin mutant s64c, monomer, semiquinone state

PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1xyva_:

Sequence; same for both SEQRES and ATOM records:

>d1xyva_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1xyva_:

• d1xyva_ first appeared in SCOP 1.71
  
• d1xyva_ appears in SCOP 1.73
  
• d1xyva_ appears in SCOPe 2.01
  
• d1xyva_ appears in the current release, SCOPe 2.08