Lineage for d1xyva_ (1xyv A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578848Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 578849Family c.23.5.1: Flavodoxin-related [52219] (4 proteins)
    binds FMN
  6. 578850Protein Flavodoxin [52220] (7 species)
  7. 578893Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
  8. 578899Domain d1xyva_: 1xyv A: [116233]
    complexed with fmn; mutant

Details for d1xyva_

PDB Entry: 1xyv (more details), 1.79 Å

PDB Description: low temperature (100k) crystal structure of flavodoxin mutant s64c, monomer, semiquinone state

SCOP Domain Sequences for d1xyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyva_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1xyva_:

Click to download the PDB-style file with coordinates for d1xyva_.
(The format of our PDB-style files is described here.)

Timeline for d1xyva_: