![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (4 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (7 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries) |
![]() | Domain d1xyva_: 1xyv A: [116233] complexed with fmn; mutant |
PDB Entry: 1xyv (more details), 1.79 Å
SCOP Domain Sequences for d1xyva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyva_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris} akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq dglridgdpraarddivgwahdvrgai
Timeline for d1xyva_: