Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1xyva_ (1xyv A:)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. Protein Flavodoxin [52220] (9 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. Domain d1xyva_: 1xyv A: [116233]
    complexed with fmn; mutant

Details for d1xyva_

PDB Entry: 1xyv (more details)
PDB Description: low temperature (100k) crystal structure of flavodoxin mutan monomer, semiquinone state
PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1xyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyva_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddcielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1xyva_:

Click to download the PDB-style file with coordinates for d1xyva_.
(The format of our PDB-style files is described here.)

Timeline for d1xyva_:

d1xyva_ appears in SCOP 1.75A


d1xyva_
(click for larger image)


d1xyva_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu