SCOPe 2.03: Domain d1xyka_: 1xyk A:

Lineage for d1xyka_ (1xyk A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein Prion protein domain [54100] (13 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [117770] (1 PDB entry)
   Uniprot O46501 124-233

8. Domain d1xyka_: 1xyk A: [116230]

Details for d1xyka_

PDB Entry: 1xyk

PDB Description: nmr structure of the canine prion protein

PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1xyka_:

Sequence; same for both SEQRES and ATOM records:

>d1xyka_ d.6.1.1 (A:) Prion protein domain {Dog (Canis familiaris) [TaxId: 9615]}
vvgglggymlgsamsrplihfgndyedryyrenmyrypdqvyyrpvdqysnqnnfvrdcv
nitvkqhtvttttkgenftetdmkimervveqmcvtqyqkeseayyqrgas

Timeline for d1xyka_:

• d1xyka_ first appeared in SCOP 1.71
  
• d1xyka_ appears in SCOPe 2.02
  
• d1xyka_ appears in SCOPe 2.04
  
• d1xyka_ appears in the current release, SCOPe 2.08