Lineage for d1xyja_ (1xyj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2499000Protein Prion protein domain [54100] (14 species)
  7. 2499005Species Cat (Felis catus) [TaxId:9685] [117769] (1 PDB entry)
    Uniprot O18754 104-214
  8. 2499006Domain d1xyja_: 1xyj A: [116229]

Details for d1xyja_

PDB Entry: 1xyj (more details)

PDB Description: NMR Structure of the cat prion protein
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1xyja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyja_ d.6.1.1 (A:) Prion protein domain {Cat (Felis catus) [TaxId: 9685]}
vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcv
nitvrqhtvttttkgenftetdmkimervveqmcvtqyqkeseayyqrras

SCOPe Domain Coordinates for d1xyja_:

Click to download the PDB-style file with coordinates for d1xyja_.
(The format of our PDB-style files is described here.)

Timeline for d1xyja_: