![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
![]() | Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (2 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118038] (1 PDB entry) |
![]() | Domain d1xygd2: 1xyg D:163-326 [116228] Other proteins in same PDB: d1xyga1, d1xygb1, d1xygc1, d1xygd1 |
PDB Entry: 1xyg (more details), 2.19 Å
SCOP Domain Sequences for d1xygd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xygd2 d.81.1.1 (D:163-326) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana)} cypttiqlplvpllkanlikheniiidaksgvsgagrgakeanlyseiaegissygvtrh rhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyed eefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvid
Timeline for d1xygd2: