Lineage for d1xygd2 (1xyg D:163-326)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606543Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 606753Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [111046] (2 species)
  7. 606754Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118038] (1 PDB entry)
  8. 606758Domain d1xygd2: 1xyg D:163-326 [116228]
    Other proteins in same PDB: d1xyga1, d1xygb1, d1xygc1, d1xygd1

Details for d1xygd2

PDB Entry: 1xyg (more details), 2.19 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g19940

SCOP Domain Sequences for d1xygd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xygd2 d.81.1.1 (D:163-326) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana)}
cypttiqlplvpllkanlikheniiidaksgvsgagrgakeanlyseiaegissygvtrh
rhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyed
eefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvid

SCOP Domain Coordinates for d1xygd2:

Click to download the PDB-style file with coordinates for d1xygd2.
(The format of our PDB-style files is described here.)

Timeline for d1xygd2: