Lineage for d1xygd1 (1xyg D:15-162,D:327-359)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1829165Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species)
  7. 1829168Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (2 PDB entries)
    Uniprot O82187 15-359
  8. 1829176Domain d1xygd1: 1xyg D:15-162,D:327-359 [116227]
    Other proteins in same PDB: d1xyga2, d1xygb2, d1xygc2, d1xygd2

Details for d1xygd1

PDB Entry: 1xyg (more details), 2.19 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g19940
PDB Compounds: (D:) putative N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d1xygd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xygd1 c.2.1.3 (D:15-162,D:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl
fp

SCOPe Domain Coordinates for d1xygd1:

Click to download the PDB-style file with coordinates for d1xygd1.
(The format of our PDB-style files is described here.)

Timeline for d1xygd1: