| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (2 PDB entries) |
| Domain d1xygb1: 1xyg B:15-162,B:327-359 [116223] Other proteins in same PDB: d1xyga2, d1xygb2, d1xygc2, d1xygd2 |
PDB Entry: 1xyg (more details), 2.19 Å
SCOP Domain Sequences for d1xygb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xygb1 c.2.1.3 (B:15-162,B:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl
fp
Timeline for d1xygb1: