SCOPe 2.08: Domain d1xygb1: 1xyg B:15-162,B:327-359

Lineage for d1xygb1 (1xyg B:15-162,B:327-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (2 PDB entries)
   Uniprot O82187 15-359

8. Domain d1xygb1: 1xyg B:15-162,B:327-359 [116223]
   Other proteins in same PDB: d1xyga2, d1xygb2, d1xygc2, d1xygd2

Details for d1xygb1

PDB Entry: 1xyg, 2.19 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g19940

PDB Compounds: (B:) putative N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d1xygb1:

Sequence; same for both SEQRES and ATOM records:

>d1xygb1 c.2.1.3 (B:15-162,B:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl
fp

Timeline for d1xygb1:

• d1xygb1 first appeared in SCOP 1.71
  
• d1xygb1 appears in SCOPe 2.07