SCOPe 2.08: Domain d1xy7b_: 1xy7 B:

Lineage for d1xy7b_ (1xy7 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.9: Hypothetical protein At5g48480 [117876] (2 proteins)
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Hypothetical protein At5g48480 [117877] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117878] (1 PDB entry)
   Uniprot Q9LV66 20-154

8. Domain d1xy7b_: 1xy7 B: [116216]

Details for d1xy7b_

PDB Entry: 1xy7, 1.8 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g48480

PDB Compounds: (B:) unknown protein

SCOPe Domain Sequences for d1xy7b_:

Sequence, based on SEQRES records:

>d1xy7b_ d.32.1.9 (B:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vftefkqmllveaqkvgdavtfyksafgaiesghslypkrkldqelphvlsselnlagss
fvvcdvsslpgfstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgk
vtdpfgvtwifae

Sequence, based on observed residues (ATOM records):

>d1xy7b_ d.32.1.9 (B:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vftefkqmllveaqkvgdavtfyksafgaiesghslhvlsselnlagssfvvcdvsslpg
fstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwif
ae

Timeline for d1xy7b_:

• d1xy7b_ first appeared in SCOP 1.71
  
• d1xy7b_ appears in SCOPe 2.07