SCOP 1.75: Domain d1xy0a_: 1xy0 A:

Lineage for d1xy0a_ (1xy0 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1xy0a_: 1xy0 A: [116211]
   Other proteins in same PDB: d1xy0b_, d1xy0d_

Details for d1xy0a_

PDB Entry: 1xy0, 1.99 Å

PDB Description: t-to-thigh transitions in human hemoglobin: alphak40g deoxy low-salt

PDB Compounds: (A:) hemoglobin alpha chain

SCOP Domain Sequences for d1xy0a_:

Sequence; same for both SEQRES and ATOM records:

>d1xy0a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttgtyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1xy0a_:

• d1xy0a_ first appeared in SCOP 1.71
  
• d1xy0a_ appears in SCOP 1.73
  
• d1xy0a_ appears in SCOPe 2.01
  
• d1xy0a_ appears in the current release, SCOPe 2.08