![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Hypothetical protein Rv1155 [117230] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries) Uniprot O06553 |
![]() | Domain d1xxob_: 1xxo B: [116206] |
PDB Entry: 1xxo (more details), 1.8 Å
SCOPe Domain Sequences for d1xxob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxob_ b.45.1.1 (B:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]} vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam vtdrrvlltlpishvyglppgmr
Timeline for d1xxob_: