Lineage for d1xxoa_ (1xxo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794190Protein Hypothetical protein Rv1155 [117230] (1 species)
  7. 2794191Species Mycobacterium tuberculosis [TaxId:1773] [117231] (4 PDB entries)
    Uniprot O06553
  8. 2794196Domain d1xxoa_: 1xxo A: [116205]

Details for d1xxoa_

PDB Entry: 1xxo (more details), 1.8 Å

PDB Description: X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase at 1.8 a resolution
PDB Compounds: (A:) hypothetical protein Rv1155

SCOPe Domain Sequences for d1xxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxoa_ b.45.1.1 (A:) Hypothetical protein Rv1155 {Mycobacterium tuberculosis [TaxId: 1773]}
vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
vtdrrvlltlpishvyglppgmr

SCOPe Domain Coordinates for d1xxoa_:

Click to download the PDB-style file with coordinates for d1xxoa_.
(The format of our PDB-style files is described here.)

Timeline for d1xxoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xxob_