![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins) Pfam PF01209 |
![]() | Protein Hypothetical protein YcgJ [117683] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117684] (2 PDB entries) Uniprot O31474 |
![]() | Domain d1xxlb1: 1xxl B:2-228 [116204] Other proteins in same PDB: d1xxla2, d1xxla3, d1xxlb2, d1xxlb3 complexed with so4 |
PDB Entry: 1xxl (more details), 2.1 Å
SCOPe Domain Sequences for d1xxlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxlb1 c.66.1.41 (B:2-228) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} glmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgven vrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyaped pvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtp adrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikr
Timeline for d1xxlb1: