SCOPe 2.08: Domain d1xxlb1: 1xxl B:2-228

Lineage for d1xxlb1 (1xxl B:2-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
   Pfam PF01209

6. Protein Hypothetical protein YcgJ [117683] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117684] (2 PDB entries)
   Uniprot O31474

8. Domain d1xxlb1: 1xxl B:2-228 [116204]
   Other proteins in same PDB: d1xxla2, d1xxla3, d1xxlb2, d1xxlb3
   complexed with so4

Details for d1xxlb1

PDB Entry: 1xxl, 2.1 Å

PDB Description: the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution

PDB Compounds: (B:) YcgJ protein

SCOPe Domain Sequences for d1xxlb1:

Sequence; same for both SEQRES and ATOM records:

>d1xxlb1 c.66.1.41 (B:2-228) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}
glmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgven
vrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyaped
pvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtp
adrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikr

Timeline for d1xxlb1:

• d1xxlb1 first appeared in SCOP 1.71, called d1xxlb_
  
• d1xxlb1 appears in SCOPe 2.07