Lineage for d1xxla_ (1xxl A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) 
Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
Pfam PF01209
Protein Hypothetical protein YcgJ [117683] (1 species) Species Bacillus subtilis [TaxId:1423] [117684] (2 PDB entries)
Uniprot O31474
Domain d1xxla_: 1xxl A: [116203]
complexed with so4
Details for d1xxla_
PDB Entry: 1xxl (more details), 2.1 Å
PDB Description: the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution
PDB Compounds: (A:) YcgJ proteinSCOPe Domain Sequences for d1xxla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}
hhhslglmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqe
kgvenvrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdh
yapedpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswik
rggtpadrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikreg
SCOPe Domain Coordinates for d1xxla_:
Click to download the PDB-style file with coordinates for d1xxla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xxla_:
- d1xxla_ first appeared in SCOP 1.71
- d1xxla_ appears in SCOPe 2.04
- d1xxla_ is called d1xxla1 in SCOPe 2.06
- d1xxla_ appears in the current release, SCOPe 2.08, called d1xxla1
View in 3D
