Lineage for d1xxla1 (1xxl A:2-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894026Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
    Pfam PF01209
  6. 2894045Protein Hypothetical protein YcgJ [117683] (1 species)
  7. 2894046Species Bacillus subtilis [TaxId:1423] [117684] (2 PDB entries)
    Uniprot O31474
  8. 2894047Domain d1xxla1: 1xxl A:2-228 [116203]
    Other proteins in same PDB: d1xxla2, d1xxla3, d1xxlb2, d1xxlb3
    complexed with so4

Details for d1xxla1

PDB Entry: 1xxl (more details), 2.1 Å

PDB Description: the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution
PDB Compounds: (A:) YcgJ protein

SCOPe Domain Sequences for d1xxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxla1 c.66.1.41 (A:2-228) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}
glmiktaecraehrvldigagaghtalafspyvqecigvdatkemvevassfaqekgven
vrfqqgtaeslpfpddsfdiitcryaahhfsdvrkavrevarvlkqdgrfllvdhyaped
pvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtp
adrekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikr

SCOPe Domain Coordinates for d1xxla1:

Click to download the PDB-style file with coordinates for d1xxla1.
(The format of our PDB-style files is described here.)

Timeline for d1xxla1: