SCOPe 2.07: Domain d1xxij2: 1xxi J:1-207

Lineage for d1xxij2 (1xxi J:1-207)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
   Uniprot P28631

8. Domain d1xxij2: 1xxi J:1-207 [116202]
   Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxif1, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1
   protein/DNA complex; complexed with adp, po4, zn

Details for d1xxij2

PDB Entry: 1xxi, 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex

PDB Compounds: (J:) DNA polymerase III, delta prime subunit

SCOPe Domain Sequences for d1xxij2:

Sequence; same for both SEQRES and ATOM records:

>d1xxij2 c.37.1.20 (J:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

Timeline for d1xxij2:

• d1xxij2 first appeared in SCOP 1.71
  
• d1xxij2 appears in SCOPe 2.06
  
• d1xxij2 appears in the current release, SCOPe 2.08