Lineage for d1xxij1 (1xxi J:208-334)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540726Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 540727Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 540728Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 540729Protein delta prime subunit [48021] (1 species)
  7. 540730Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
  8. 540736Domain d1xxij1: 1xxi J:208-334 [116201]
    Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij2
    complexed with adp, po4, zn

Details for d1xxij1

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex

SCOP Domain Sequences for d1xxij1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxij1 a.80.1.1 (J:208-334) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

SCOP Domain Coordinates for d1xxij1:

Click to download the PDB-style file with coordinates for d1xxij1.
(The format of our PDB-style files is described here.)

Timeline for d1xxij1: