![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily) core: 5 helices: bundle |
![]() | Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
![]() | Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
![]() | Protein gamma subunit [63578] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63579] (3 PDB entries) |
![]() | Domain d1xxih1: 1xxi H:243-368 [116197] Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib2, d1xxic2, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig2, d1xxih2, d1xxii2, d1xxij1, d1xxij2 |
PDB Entry: 1xxi (more details), 4.1 Å
SCOP Domain Sequences for d1xxih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxih1 a.80.1.1 (H:243-368) gamma subunit {Escherichia coli} tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr mplpep
Timeline for d1xxih1: