![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64032] (3 PDB entries) |
![]() | Domain d1xxig2: 1xxi G:5-242 [116196] Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxic1, d1xxid1, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxih1, d1xxii1, d1xxij1, d1xxij2 |
PDB Entry: 1xxi (more details), 4.1 Å
SCOP Domain Sequences for d1xxig2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxig2 c.37.1.20 (G:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli} vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
Timeline for d1xxig2: