Lineage for d1xxif1 (1xxi F:212-338)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332241Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2332242Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2332243Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 2332252Protein delta subunit [63580] (1 species)
  7. 2332253Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
    Uniprot P28630
  8. 2332260Domain d1xxif1: 1xxi F:212-338 [116193]
    Other proteins in same PDB: d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2
    protein/DNA complex; complexed with adp, po4, zn

Details for d1xxif1

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (F:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1xxif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxif1 a.80.1.1 (F:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad

SCOPe Domain Coordinates for d1xxif1:

Click to download the PDB-style file with coordinates for d1xxif1.
(The format of our PDB-style files is described here.)

Timeline for d1xxif1: