Lineage for d1xxid1 (1xxi D:243-368)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772824Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 772825Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 772826Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 772844Protein gamma subunit [63578] (2 species)
  7. 772845Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
    Uniprot P06710 5-368
  8. 772857Domain d1xxid1: 1xxi D:243-368 [116189]
    Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib2, d1xxic2, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig2, d1xxih2, d1xxii2, d1xxij1, d1xxij2

Details for d1xxid1

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (D:) DNA polymerase III subunit gamma

SCOP Domain Sequences for d1xxid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxid1 a.80.1.1 (D:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOP Domain Coordinates for d1xxid1:

Click to download the PDB-style file with coordinates for d1xxid1.
(The format of our PDB-style files is described here.)

Timeline for d1xxid1: