SCOP 1.71: Domain d1xxid1: 1xxi D:243-368

Lineage for d1xxid1 (1xxi D:243-368)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein gamma subunit [63578] (1 species)

7. Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)

8. Domain d1xxid1: 1xxi D:243-368 [116189]
   Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib2, d1xxic2, d1xxid2, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig2, d1xxih2, d1xxii2, d1xxij1, d1xxij2

Details for d1xxid1

PDB Entry: 1xxi, 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex

SCOP Domain Sequences for d1xxid1:

Sequence; same for both SEQRES and ATOM records:

>d1xxid1 a.80.1.1 (D:243-368) gamma subunit {Escherichia coli}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

Timeline for d1xxid1:

• d1xxid1 is new in SCOP 1.71
  
• d1xxid1 appears in SCOP 1.73
  
• d1xxid1 appears in the current release, SCOPe 2.08