SCOP 1.71: Domain d1xxic2: 1xxi C:5-242

Lineage for d1xxic2 (1xxi C:5-242)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species)

7. Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)

8. Domain d1xxic2: 1xxi C:5-242 [116188]
   Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxic1, d1xxid1, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxih1, d1xxii1, d1xxij1, d1xxij2

Details for d1xxic2

PDB Entry: 1xxi, 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex

SCOP Domain Sequences for d1xxic2:

Sequence; same for both SEQRES and ATOM records:

>d1xxic2 c.37.1.20 (C:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

Timeline for d1xxic2:

• d1xxic2 is new in SCOP 1.71
  
• d1xxic2 appears in SCOP 1.73
  
• d1xxic2 appears in the current release, SCOPe 2.08