Lineage for d1xxib2 (1xxi B:5-242)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697666Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 697759Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species)
  7. 697760Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)
  8. 697770Domain d1xxib2: 1xxi B:5-242 [116186]
    Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxic1, d1xxid1, d1xxie1, d1xxie2, d1xxif1, d1xxif2, d1xxig1, d1xxih1, d1xxii1, d1xxij1, d1xxij2

Details for d1xxib2

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (B:) DNA polymerase III subunit gamma

SCOP Domain Sequences for d1xxib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxib2 c.37.1.20 (B:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

SCOP Domain Coordinates for d1xxib2:

Click to download the PDB-style file with coordinates for d1xxib2.
(The format of our PDB-style files is described here.)

Timeline for d1xxib2: