Class a: All alpha proteins [46456] (258 folds) |
Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein delta subunit [63580] (1 species) |
Species Escherichia coli [TaxId:562] [63581] (4 PDB entries) |
Domain d1xxia1: 1xxi A:212-338 [116183] Other proteins in same PDB: d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2 |
PDB Entry: 1xxi (more details), 4.1 Å
SCOP Domain Sequences for d1xxia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxia1 a.80.1.1 (A:212-338) delta subunit {Escherichia coli [TaxId: 562]} ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll chkplad
Timeline for d1xxia1: