SCOP 1.73: Domain d1xxia1: 1xxi A:212-338

Lineage for d1xxia1 (1xxi A:212-338)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein delta subunit [63580] (1 species)

7. Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)

8. Domain d1xxia1: 1xxi A:212-338 [116183]
   Other proteins in same PDB: d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxie2, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1, d1xxij2

Details for d1xxia1

PDB Entry: 1xxi, 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex

PDB Compounds: (A:) DNA Polymerase III, DELTA SUBUNIT

SCOP Domain Sequences for d1xxia1:

Sequence; same for both SEQRES and ATOM records:

>d1xxia1 a.80.1.1 (A:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad

Timeline for d1xxia1:

• d1xxia1 first appeared in SCOP 1.71
  
• d1xxia1 appears in SCOP 1.75
  
• d1xxia1 appears in the current release, SCOPe 2.08