Lineage for d1xxhj1 (1xxh J:208-334)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540726Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 540727Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 540728Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 540729Protein delta prime subunit [48021] (1 species)
  7. 540730Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
  8. 540734Domain d1xxhj1: 1xxh J:208-334 [116181]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj2
    complexed with atg, po4, zn

Details for d1xxhj1

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

SCOP Domain Sequences for d1xxhj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhj1 a.80.1.1 (J:208-334) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlpvphl

SCOP Domain Coordinates for d1xxhj1:

Click to download the PDB-style file with coordinates for d1xxhj1.
(The format of our PDB-style files is described here.)

Timeline for d1xxhj1: