Lineage for d1xxhh1 (1xxh H:243-368)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004351Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2004352Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2004353Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 2004371Protein gamma subunit [63578] (2 species)
  7. 2004372Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
    Uniprot P06710 5-368
  8. 2004380Domain d1xxhh1: 1xxh H:243-368 [116177]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb2, d1xxhc2, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg2, d1xxhh2, d1xxhi2, d1xxhj1, d1xxhj2
    protein/DNA complex; complexed with ags, po4, zn

Details for d1xxhh1

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (H:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1xxhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhh1 a.80.1.1 (H:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOPe Domain Coordinates for d1xxhh1:

Click to download the PDB-style file with coordinates for d1xxhh1.
(The format of our PDB-style files is described here.)

Timeline for d1xxhh1: