SCOPe 2.04: Domain d1xxhh1: 1xxh H:243-368

Lineage for d1xxhh1 (1xxh H:243-368)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein gamma subunit [63578] (2 species)

7. Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
   Uniprot P06710 5-368

8. Domain d1xxhh1: 1xxh H:243-368 [116177]
   Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb2, d1xxhc2, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg2, d1xxhh2, d1xxhi2, d1xxhj1, d1xxhj2
   protein/DNA complex; complexed with ags, po4, zn

Details for d1xxhh1

PDB Entry: 1xxh, 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

PDB Compounds: (H:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1xxhh1:

Sequence; same for both SEQRES and ATOM records:

>d1xxhh1 a.80.1.1 (H:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

Timeline for d1xxhh1:

• d1xxhh1 first appeared in SCOP 1.71
  
• d1xxhh1 appears in SCOPe 2.03
  
• d1xxhh1 appears in SCOPe 2.05
  
• d1xxhh1 appears in the current release, SCOPe 2.08