Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species) |
Species Escherichia coli [TaxId:562] [64032] (3 PDB entries) Uniprot P06710 5-368 |
Domain d1xxhg2: 1xxh G:5-242 [116176] Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhc1, d1xxhd1, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhh1, d1xxhi1, d1xxhj1, d1xxhj2 protein/DNA complex; complexed with ags, po4, zn |
PDB Entry: 1xxh (more details), 3.45 Å
SCOPe Domain Sequences for d1xxhg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxhg2 c.37.1.20 (G:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg
Timeline for d1xxhg2: