![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64034] (5 PDB entries) Uniprot P28630 |
![]() | Domain d1xxhf2: 1xxh F:1-211 [116174] Other proteins in same PDB: d1xxha1, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1, d1xxhj2 protein/DNA complex; complexed with ags, po4, zn |
PDB Entry: 1xxh (more details), 3.45 Å
SCOPe Domain Sequences for d1xxhf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxhf2 c.37.1.20 (F:1-211) delta subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla laqalerlsllwpdgkltlprveqavndaah
Timeline for d1xxhf2: