Lineage for d1xxhe2 (1xxh E:1-207)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583379Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 583427Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 583428Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
  8. 583437Domain d1xxhe2: 1xxh E:1-207 [116172]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1

Details for d1xxhe2

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

SCOP Domain Sequences for d1xxhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhe2 c.37.1.20 (E:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

SCOP Domain Coordinates for d1xxhe2:

Click to download the PDB-style file with coordinates for d1xxhe2.
(The format of our PDB-style files is described here.)

Timeline for d1xxhe2: