Class a: All alpha proteins [46456] (289 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein delta prime subunit [48021] (1 species) |
Species Escherichia coli [TaxId:562] [48022] (4 PDB entries) Uniprot P28631 |
Domain d1xxhe1: 1xxh E:208-334 [116171] Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj2 protein/DNA complex; complexed with ags, po4, zn |
PDB Entry: 1xxh (more details), 3.45 Å
SCOPe Domain Sequences for d1xxhe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxhe1 a.80.1.1 (E:208-334) delta prime subunit {Escherichia coli [TaxId: 562]} dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv vlpvphl
Timeline for d1xxhe1: