SCOP 1.71: Domain d1xxhd2: 1xxh D:5-242

Lineage for d1xxhd2 (1xxh D:5-242)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species)

7. Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)

8. Domain d1xxhd2: 1xxh D:5-242 [116170]
   Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhc1, d1xxhd1, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhh1, d1xxhi1, d1xxhj1, d1xxhj2

Details for d1xxhd2

PDB Entry: 1xxh, 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

SCOP Domain Sequences for d1xxhd2:

Sequence; same for both SEQRES and ATOM records:

>d1xxhd2 c.37.1.20 (D:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

Timeline for d1xxhd2:

• d1xxhd2 is new in SCOP 1.71
  
• d1xxhd2 appears in SCOP 1.73
  
• d1xxhd2 appears in the current release, SCOPe 2.08