Lineage for d1xxhc2 (1xxh C:5-242)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583379Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 583451Protein gamma subunit of DNA polymerase III, N-domain [64031] (1 species)
  7. 583452Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)
  8. 583457Domain d1xxhc2: 1xxh C:5-242 [116168]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb1, d1xxhc1, d1xxhd1, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg1, d1xxhh1, d1xxhi1, d1xxhj1, d1xxhj2

Details for d1xxhc2

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex

SCOP Domain Sequences for d1xxhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhc2 c.37.1.20 (C:5-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli}
vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

SCOP Domain Coordinates for d1xxhc2:

Click to download the PDB-style file with coordinates for d1xxhc2.
(The format of our PDB-style files is described here.)

Timeline for d1xxhc2: