Lineage for d1xxhb1 (1xxh B:243-368)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644559Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 644560Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 644561Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 644579Protein gamma subunit [63578] (2 species)
  7. 644580Species Escherichia coli [TaxId:562] [63579] (3 PDB entries)
  8. 644584Domain d1xxhb1: 1xxh B:243-368 [116165]
    Other proteins in same PDB: d1xxha1, d1xxha2, d1xxhb2, d1xxhc2, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf1, d1xxhf2, d1xxhg2, d1xxhh2, d1xxhi2, d1xxhj1, d1xxhj2

Details for d1xxhb1

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (B:) DNA polymerase III subunit gamma

SCOP Domain Sequences for d1xxhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhb1 a.80.1.1 (B:243-368) gamma subunit {Escherichia coli [TaxId: 562]}
tldddqalslveamveangervmalineaaargieweallvemlgllhriamvqlspaal
gndmaaielrmrelartipptdiqlyyqtlligrkelpyapdrrmgvemtllralafhpr
mplpep

SCOP Domain Coordinates for d1xxhb1:

Click to download the PDB-style file with coordinates for d1xxhb1.
(The format of our PDB-style files is described here.)

Timeline for d1xxhb1: