Class b: All beta proteins [48724] (165 folds) |
Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) |
Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) |
Protein Ecotin, trypsin inhibitor [49774] (1 species) |
Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) |
Domain d1xxfd_: 1xxf D: [116162] Other proteins in same PDB: d1xxfa_, d1xxfb_ complexed with na; mutant |
PDB Entry: 1xxf (more details), 2.6 Å
SCOP Domain Sequences for d1xxfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxfd_ b.16.1.1 (D:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl egwgydyyvfdkvsspdftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd vkyrvwkaeekidnavvr
Timeline for d1xxfd_: