Lineage for d1xxfc_ (1xxf C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554792Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 554793Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 554794Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 554795Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 554796Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
  8. 554817Domain d1xxfc_: 1xxf C: [116161]
    Other proteins in same PDB: d1xxfa_, d1xxfb_

Details for d1xxfc_

PDB Entry: 1xxf (more details), 2.6 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotin mutant (ecotinp)

SCOP Domain Sequences for d1xxfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxfc_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspdftrvvcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

SCOP Domain Coordinates for d1xxfc_:

Click to download the PDB-style file with coordinates for d1xxfc_.
(The format of our PDB-style files is described here.)

Timeline for d1xxfc_: