SCOPe 2.07: Domain d1xxfb_: 1xxf B:

Lineage for d1xxfb_ (1xxf B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor XI [117237] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117238] (58 PDB entries)
   Uniprot P03951 388-624

8. Domain d1xxfb_: 1xxf B: [116160]
   Other proteins in same PDB: d1xxfc_, d1xxfd_
   complexed with na; mutant

Details for d1xxfb_

PDB Entry: 1xxf, 2.6 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotin mutant (ecotinp)

PDB Compounds: (B:) Coagulation factor XI

SCOPe Domain Sequences for d1xxfb_:

Sequence; same for both SEQRES and ATOM records:

>d1xxfb_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

Timeline for d1xxfb_:

• d1xxfb_ first appeared in SCOP 1.71
  
• d1xxfb_ appears in SCOPe 2.06
  
• d1xxfb_ appears in the current release, SCOPe 2.08