Lineage for d1xxfb_ (1xxf B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128053Protein Coagulation factor XI [117237] (1 species)
  7. 1128054Species Human (Homo sapiens) [TaxId:9606] [117238] (26 PDB entries)
    Uniprot P03951 388-624
  8. 1128081Domain d1xxfb_: 1xxf B: [116160]
    Other proteins in same PDB: d1xxfc_, d1xxfd_
    complexed with na; mutant

Details for d1xxfb_

PDB Entry: 1xxf (more details), 2.6 Å

PDB Description: Crystal Structure of the FXIa Catalytic Domain in Complex with Ecotin Mutant (EcotinP)
PDB Compounds: (B:) Coagulation factor XI

SCOPe Domain Sequences for d1xxfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxfb_ b.47.1.2 (B:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeikedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1xxfb_:

Click to download the PDB-style file with coordinates for d1xxfb_.
(The format of our PDB-style files is described here.)

Timeline for d1xxfb_: